Detalhes da empresa
  • Conbott Pharmtech Co.,Ltd.

  •  [Zhejiang,China]
  • Tipo de Negócio:Fabricante
  • Main Mark: África , Americas , Ásia , Caribe , leste Europeu , Europa , Médio Oriente , Norte da Europa , Oceânia , Outros Mercados , Europa Ocidental , No mundo todo
  • Exportador:71% - 80%
  • certs:COS, ISO9001, ISO14010, FDA
  • Descrição:52232-67-4,CAS 52232-67-4,CAS NO 52232-67-4
Conbott Pharmtech Co.,Ltd. 52232-67-4,CAS 52232-67-4,CAS NO 52232-67-4
  • Title
  • Todos
Grupo de Produto
Serviço on-line
http://pt.conbottpharm.comDigitalizar para visitar
Casa > Lista de Produto > Síntese do peptide > Acetato de Teriparatida de Qualidade Superior CAS 52232-67-4

Acetato de Teriparatida de Qualidade Superior CAS 52232-67-4

Compartilhar no:  
    Tipo de pagamento: T/T,L/C
    Quantidade de pedido mínimo: 1 Gram
    Tempo de entrega: 10 dias
  • Mr. Tommy

Informação básica

Modelo: 52232-67-4

Additional Info

Pacote: Como requerido

produtividade: Customized

marca: Conbottpharm

transporte: Ocean,Air

Lugar de origem: China

Habilidade da fonte: Commercial

Certificados : Documents Support

Descrição do produto

Nós somos um dos Teriparatide A Cetate CAS 52232-67-4 fornecedores no mercado chinês. Teriparatide é uma forma recombinante de hormônio paratiróide. É uma anabólica eficaz (isto é, crescimento de osso) agente usado no tratamento de algumas formas de osteoporose e também, ocasionalmente, utilizado fora do rótulo para acelerar a cicatrização da fractura. Teriparatide A Cetate 52232-67-4 é conhecida pela ação rápida, qualidade constante e elevada pureza. Somos apreciados por muitos clientes que cooperamos.

Thera. Categoria: Teriparatide Acetate

CAS. : 52232-67-4

Sinônimo: Paratormônio HUMANO: Fragmento 1-34; A hormona paratiróide (HUMANO, 1-34); Hormona paratiróide (1-34), humana; PTH (1-34) (humano); PTH (HUMANO, 1-34); teriparatida; Acetato de teriparatida; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF


Fórmula molecular: C172H278N52O47S2

Molecular Pesar t: 3.890,49792

Ensaio:. ≥99%

Embalagem: Exportação de embalagem digna

Ficha de Segurança lMaterial: Disponível a pedido

Utilização: Um fragmento de sequência de péptido de hormona paratiróide humana (hPTH) contendo os 34 resíduos N-terminais de hPTH. Verificou-se também que este fragmento era um agonista nos receptores PTH1 e PTH2

Grupo de Produto : Síntese do peptide

imagem de Produto
  • Acetato de Teriparatida de Qualidade Superior CAS 52232-67-4
Enviar e-mail para este fornecedor
  • *Assunto:
  • *Mensagens:
    Sua mensagem deve estar entre 20-8000 caracteres

Mobile site índice. Mapa do Site

Assine a nossa newsletter:
Receba as atualizações, Ofertas Especiais, grandes Prêmios, descontos

Copyright © 2019 Conbott Pharmtech Co.,Ltd.Todos os direitos reservados.
Comunique-se com o fornecedor?fornecedor
Tommy Mr. Tommy
O que posso fazer por você?