Detalhes da empresa
  • Conbott Pharmtech Co.,Ltd.

  •  [Zhejiang,China]
  • Tipo de Negócio:Fabricante
  • Main Mark: África , Americas , Ásia , Caribe , leste Europeu , Europa , Médio Oriente , Norte da Europa , Oceânia , Outros Mercados , Europa Ocidental , No mundo todo
  • Exportador:71% - 80%
  • certs:COS, ISO9001, ISO14010, FDA
  • Descrição:106612-94-6,CAS 106612-94-6,Nº CAS 106612-94-6
Conbott Pharmtech Co.,Ltd. 106612-94-6,CAS 106612-94-6,Nº CAS 106612-94-6
Title
  • Title
  • Todos
Grupo de Produto
Serviço on-line
http://pt.conbottpharm.comDigitalizar para visitar
Casa > Lista de Produto > Síntese do peptide > 99% Hormone de Crescimento Humano Péptido GLP-1 CAS 106612-94-6

99% Hormone de Crescimento Humano Péptido GLP-1 CAS 106612-94-6

Compartilhar no:  
    Tipo de pagamento: T/T,L/C
    Quantidade de pedido mínimo: 1 Gram
    Tempo de entrega: 10 dias
  • Mr. Tommy

Informação básica

Modelo: 106612-94-6

Additional Info

Pacote: Como requerido

produtividade: Customized

marca: Conbottpharm

transporte: Ocean,Air

Lugar de origem: China

Habilidade da fonte: Commercial

Certificados : Documents Support

Descrição do produto

Oferecemos grande qualidade e alta pureza GLP-1 CAS 106612-94-6. Glucagon como peptídeo -1 (GLP-1) é um cérebro peptídeos intestinos secreção ileal células endócrinas, presentemente principalmente como um alvo para a ação de drogas de diabetes tipo 2. A vantagem de GLP-1 CAS 106612-94-6 pode reduzir a inibição do esvaziamento gástrico, o peristaltismo intestinal. Isto proporciona uma perspectiva muito boa para o tratamento do diabetes mellitus tipo 2. Mas porque GLP-1 é um polipéptido, não pode ser administrado por via oral é uma grande deficiência. Estamos hábil para produzir alta pureza GLP 1. Nós podemos fornecer embalagens diferentes para atender a exigência de clientes.


Thera. Categoria: Anti-diabetes tipo 2

CAS. : 106612-94-6

Sinónimo: proglucagon (78-108) (humana, bovina, cobaia, murganho, rato); Preproglucagom 78-108 HUMANO; Preproglucagon (98-128) (humana, bovina, cobaia, murganho, rato); Insulinotropina (humana, bovina, cobaia, murganho, rato); GLU-GLY-GLN-ALA-LIS-GLU-PHE-ILE-ALA-TRP-AL-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU- LEU-VAL-LYS-GLY-ARG-GLY; GLU-GLY-GLN-ALA-LYS-GLU-PHE-ILE-ALA-GL-GLY-GLL-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR- TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG; GLP-1 (HUMANO, 7-37) (BOVINO, CANINO, RATO, PORCO DA GUINÉ)


106612-94-6


Fórmula molecular: C151H228N40O47

Molecular Pesar t: 3.355,67

Ensaio:. ≥99%

Embalagem: Exportação de embalagem digna

Ficha de Segurança lMaterial: Disponível a pedido

Uso: O GLP-1 pode obviamente melhorar a glucose no sangue em modelos animais de diabetes tipo 2 ou pacientes através de uma variedade de mecanismos, que promovem a regeneração e reparação de células beta das ilhotas, aumentar o número de células beta é papel particularmente significativa


Grupo de Produto : Síntese do peptide

imagem de Produto
  • 99% Hormone de Crescimento Humano Péptido GLP-1 CAS 106612-94-6
Enviar e-mail para este fornecedor
  • *Assunto:
  • *Mensagens:
    Sua mensagem deve estar entre 20-8000 caracteres

Mobile site índice. Mapa do Site


Assine a nossa newsletter:
Receba as atualizações, Ofertas Especiais, grandes Prêmios, descontos

MultiLanguage:
Copyright © 2019 Conbott Pharmtech Co.,Ltd.Todos os direitos reservados.
Comunique-se com o fornecedor?fornecedor
Tommy Mr. Tommy
O que posso fazer por você?
Fornecedor